PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG410000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 253aa    MW: 26847.7 Da    PI: 6.8644
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG410000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.54.7e-5432127297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdr++Pianv+rim++vlP++akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa++ lGf+dyvepl+vyl++yr
  Pavir.1NG410000.1.p  32 REQDRLMPIANVIRIMRRVLPSHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLSVYLHRYR 121
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+ege 
  Pavir.1NG410000.1.p 122 EFEGEA 127
                          ***985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.9E-4925129IPR009072Histone-fold
SuperFamilySSF471135.74E-3834131IPR009072Histone-fold
PfamPF008082.2E-2538101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.3E-176583No hitNo description
PROSITE patternPS0068506884IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.3E-1784102No hitNo description
PRINTSPR006157.3E-17103121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MDPASGFLPS GAANGTAAAG GGGQQQAPPP IREQDRLMPI ANVIRIMRRV LPSHAKISDD  60
AKETIQECVS EYISFITGEA NERCQREQRK TITAEDVLWA MSRLGFDDYV EPLSVYLHRY  120
REFEGEARGV VGLGAPRGGD HHHHHSSMAP HHHDMQLHAS MYGPPAVPPS GAPHHGHGLV  180
SMPHHGGGGH QYLPYPYEAA YGGEHAMAAY YGSAAAYGAP GNGGSGDGSG GSASRTRQGG  240
SFEHPHPFAS YK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B5e-4031122192Transcription factor HapC (Eurofung)
4g91_B5e-4031122192Transcription factor HapC (Eurofung)
4csr_A7e-4032122494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B7e-4032122494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432570.0AC243257.1 Panicum virgatum clone PV_ABa103-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953763.11e-106PREDICTED: nuclear transcription factor Y subunit B-2
TrEMBLK3Z0M51e-106K3Z0M5_SETIT; Uncharacterized protein
STRINGSi020091m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.26e-63nuclear factor Y, subunit B6